Our recombinant human EGF growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).
Recombinant EGF Human
For research use only
Epidermal Growth Factor, known as EGF, is a single polypeptide found in the human body.
It stimulates the growth of various epidermal and epithelial cells in vivo and in vitro, and of some fibroblasts in cell culture. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing.
Source
Sequence
Human EGF recombinant protein is a monomeric peptide of 53 amino acid residues.
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Formulation
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.4
Purity
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
Biological Activity
ED50 <0.4 ng/ml determined by the EGF dose dependent proliferation of HaCaT cells and MTT assay determination. Determine the optimal concentration for each specific application using an initial dose response assay.
Molecular Weight
7.5 kDa
Format
Liquid Frozen, contact us for lyophilized product.
Downloads
Request a sample or discuss quantities
Interested in testing our products in your process? Get in touch with us to request a complimentary sample for your testing needs, or if you wish to discuss order quantities, please fill in the form.
