Our recombinant bovine FGF-2 growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).
![](https://cocoonbio.com/wp-content/uploads/2024/04/FGF2-Bovine-Large.jpg)
Recombinant FGF-2 Bovine
For research use only
Basic Fibroblast Growth Factor, known as FGF basic or FGF-2, is a member of the fibroblast growth factor FGF family.
FGF-2 controls fundamental biological processes, including cell growth and differentiation, tissue formation, tissue repair and angiogenesis. It’s commonly used as an ingredient for serum-free culture media for cultivated meat, cell culture applications, and for veterinary research applications.
Source
Sequence
Bovine FGF-2 recombinant protein is a monomeric peptide of 155 amino acid residues.
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Formulation
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.5
Purity
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
Biological Activity
ED50 <5 ng/ml in cellular/luciferase assays determined by the FGF2 dose dependent activation of the EF-1α promoter in 2 INDFH-NucRedLight cells. Determine the optimal concentration for each specific application using an initial dose response assay.
Molecular Weight
18.5 kDa
Format
Liquid Frozen, contact us for lyophilized product.
Request a sample or discuss quantities
Interested in testing our products in your process? Get in touch with us to request a complimentary sample for your testing needs, or if you wish to discuss order quantities, please fill in the form.