Our recombinant human PDGF growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).

Recombinant PDGF Human
For research use only
Platelet-derived growth factor, known as PDGF, refers to a family of dimeric isoforms that have an effect on connective tissue cells, as well as on other types of cells.
It affects the differentiation of specific cell types and promotes cell survival. Through these effects, PDGF has important functions in certain organs during embryonic development, as well as in the adult stage in the stimulation of wound healing and in the maintenance of connective tissue homeostasis.
Source
Sequence
Human PDGF-BB recombinant protein is a dimeric peptide of 109 amino acid residues.
SLGSLTIAEPAMIAECKTRTEVFEISRSLIDPTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Formulation
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.4
Purity
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
Biological Activity
ED50 < 5 ng/ml determined by the PDGF-BB dose dependent cellular proliferation of NIH-3T3 cells via fluorescence assay determination. Determine the optimal concentration for each specific application using an initial dose response assay.
Molecular Weight
26.2 kDa
Format
Liquid Frozen, contact us for lyophilized product.
Downloads
Request a sample or discuss quantities
Interested in testing our products in your process? Get in touch with us to request a complimentary sample for your testing needs, or if you wish to discuss order quantities, please fill in the form.