Our recombinant porcine PDGF growth factor is produced in non-GMO insects, specifically in Trichoplusia ni (cabbage moth) with the Baculovirus Expression Vector System (BEVS).

Recombinant PDGF Porcine
For research use only
Platelet-derived Growth Factor, known as PDGF, is a member of the platelet-derived growth factor family.
It’s a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle and connective tissue, and it plays a key role in embryonic development, cell proliferation, cell migration, and angiogenesis. Porcine PDGF consists primarily of PDGF homodimers and it has approximately 70-80% homology with the B-chain of human PDGF. Human and porcine PDGF bind to the same receptors and produce the same spectrum of biological effects.
Source
Sequence
Porcine PDGF-BB recombinant protein is a dimeric peptide of 108 amino acid residues.
SLGSPTVAEPAVIAECKTRTEVFEISRSLIDPTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVVARPVT
Formulation
Phosphate 20mM; NaCl 500mM; Tween20 0.05%; pH 7.4
Purity
> 80% measured by SDS page, and resolved under reduced (R) and non-reduced (NR) conditions. Higher purity available upon request.
Biological Activity
ED50 < 5 ng/ml determined by the PDGF-BB dose dependent cellular proliferation of INHDF-NucLightRed cells via fluorescence assay determination. Determine the optimal concentration for each specific application using an initial dose response assay.
Molecular Weight
25.6 kDa
Format
Liquid Frozen, contact us for lyophilized product.
Downloads
Request a sample or discuss quantities
Interested in testing our products in your process? Get in touch with us to request a complimentary sample for your testing needs, or if you wish to discuss order quantities, please fill in the form.